PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00026987-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 526aa    MW: 59145.9 Da    PI: 5.8398
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00026987-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.1e-1577121147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r rWT++E+++++da k++G   W+ I +++g ++ + q++s+ qk+
  PSME_00026987-RA  77 RERWTEDEHKKFLDALKLYGRS-WRHIEEHIG-TKRAVQIRSHAQKF 121
                       78******************55.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.54E-1471127IPR009057Homeodomain-like
PROSITE profilePS5129417.4872126IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-774123IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-1575124IPR006447Myb domain, plants
SMARTSM007173.2E-1176124IPR001005SANT/Myb domain
PfamPF002493.3E-1277120IPR001005SANT/Myb domain
CDDcd001671.11E-879122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MEFLQPRRKS KTYDKADQDL AVSAVRTFSV SSYVRGDVIE TVEEGENLFS IDEPLLKFSL  60
LSLLDQVRKP YTITKQRERW TEDEHKKFLD ALKLYGRSWR HIEEHIGTKR AVQIRSHAQK  120
FFTKLEKGAS TGTNSTMTDQ YLEIPPPRPK RKPGHPYPKK TGVICRGGDL SVAEEDSLTR  180
GCEVSDISAA TLDGERECSK LTELAQHNSK SRPFYKPEMT QGTLQPSLMS TSLKLFGRTL  240
VVQNSFTDDF LITSVKNEAI CSEIYAENKD APCEDGILDC RRIRKDTFSP EESETDTIQS  300
VNNSTGRSTI NKSSVFSNTN WSSALLNSCH SSSSEDEKIQ SSYPQVLRDG SLEVGLQQKP  360
EAPEVKGKYT DQSKEEEERQ RNKSLMQLQN KIGLQAQPWT LDAGEIISNV SHNYKMPHPG  420
NIVLQSNLSP TPLTEGCSFK MASASQSSDG DPFKEECSMT FHHSETSVDS ISDFQILHDM  480
SSIGSMLCSK SRGENRTYSG EGFVPYKRCQ IDGQSPRESD NEEYNL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0855340.0EF085534.1 Picea sitchensis clone WS02728_K17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NW270.0A9NW27_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.41e-30MYB_related family protein